PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi006715
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family G2-like
Protein Properties Length: 384aa    MW: 42924.2 Da    PI: 5.4826
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Psi#S50823779PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.82.9e-343690155
    G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
               kprlrWt+eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQkYRl
  Psi006715 36 KPRLRWTTELHERFVDAVTQLGGPDKATPKTIMRAMGVKGLTLYHLKSHLQKYRL 90
               79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.863393IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-333391IPR009057Homeodomain-like
SuperFamilySSF466893.94E-173591IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-243691IPR006447Myb domain, plants
PfamPF002496.4E-93889IPR001005SANT/Myb domain
PfamPF143792.5E-27132178IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MSSLEKPPSF EETQSGPLEG TNLPGDACLV LTTDPKPRLR WTTELHERFV DAVTQLGGPD  60
KATPKTIMRA MGVKGLTLYH LKSHLQKYRL GKQPFKEFSD QSNKDASCLT EGQGASTCSS  120
SKMINQDVNE SFQITEALRV QMEVQRRLHE QLEVQRHLQL RIEAQGKYLQ SILEKACQAL  180
TDQTIASAGL EAARQELSEL AMKVSNGCLS SPFEDVNLPS LPEIPQIHVD ESTLHQQTQL  240
TDCSVDSCLT SNESTPKIPQ EDMQAVRNKR SRPLYCDNDA LVWDNDVRND LRLQELSAAC  300
LSQVGNLNEE EQMPSVSPIE SHSERNSMKD EFDTRMTKTK DGIGNPAERE LQSSPKLERP  360
AARRATHLVH DRISSQVKGG PFFL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Psi.12230.0shoot
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006840145.11e-141PREDICTED: myb family transcription factor APL
TrEMBLC0PPV30.0C0PPV3_PICSI; Putative uncharacterized protein
STRINGVIT_05s0029g00060.t011e-114(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.11e-111G2-like family protein